PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00020379-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family Nin-like
Protein Properties Length: 718aa    MW: 79989.2 Da    PI: 7.0883
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00020379-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.28.1e-29569619252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek+isle l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  PSME_00020379-RA 569 EKTISLEILQQYFAGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKINKV 619
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.245558639IPR003035RWP-RK domain
PfamPF020422.0E-25571619IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MKASLDQKKT KRMDWEAWME ETGLFSLGPL QSVVAPPRSP APSAYMSDGD GDLSLRKKMM  60
QALRYIKDSE STGQNVLVQV WVPVRQGAKN MLTTYGQPFV LAFPNCGLFQ YRTVSSTFLF  120
SAGEEGEDEV EVSDGIGHSH ALLGLPGRVF QRKLPEWTPN VQYYSMSEYP RVTHAQHYNV  180
RGTVALPVFE PRGQSCVGVV ELIMTAQKIN YAPEVDKVCR ALQICNEGRQ AALAEILAVL  240
TAVCEAHKLP LAQTWVPCKH RNVITTGVGK KKNCVSFDGS CMGQVCMSTI NSAFYVIDAD  300
MWGFRDACTE HHLQKGQGLP GRAFASNQPC FSNDISSFSK MEYPLVHYTR LFSLAAAVAI  360
RVRSTHTGND DYILEFFLNT ECKDSQKLQM QLKTLSVTMN HVCQSLRMLT NKELEEEKVL  420
EVSKEFESFD SQNEFPEYVQ WKTCNNISRI SPELQISPAA EFVQWQERKE TVRQESFQQA  480
LQVGSEGDQN EIQMGQQVVA SLPFVSYQKQ QPEPEGSTLS DLKHHRHELA QVNNEIPAVL  540
ANDDILCSGS FQEHTNIIKG LEKKRGKIEK TISLEILQQY FAGSLKDAAK NIGVCPTTLK  600
RICRQHGISR WPSRKINKVN RSLKKLQGVI ESVKGVEGAF KIETLKTGLV SSAMVPNKVV  660
SNNSSVQGKS SLAVVEGAAN HVHDMVPPPT NEEVTGMKTT LPGEDCIMPE DFSSSQCQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1222590.0BT122259.1 Picea sitchensis clone WS0442_G03 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006844913.10.0PREDICTED: protein NLP6
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLD5A7X90.0D5A7X9_PICSI; Putative uncharacterized protein
STRINGPGSC0003DMT4000148370.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.11e-143NIN like protein 7